PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_020784-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 276aa    MW: 31578.6 Da    PI: 7.4391
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_020784-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.77.4e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT eEd++l+ ++k++G  +W   +++ g+ R++k+c++rw +yl
    NNU_020784-RA 14 KGTWTLEEDQKLIAYIKRYGHWNWLQLPKYAGLSRCGKSCRLRWMNYL 61
                     799*****************99************************97 PP

2Myb_DNA-binding55.99.6e-1867112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ + eE+e +++++++lG++ W++Ia++++ gRt++++k++w+++l
    NNU_020784-RA  67 RGNYSREEEEAIINLHEKLGNK-WTAIAARLP-GRTDNEIKNHWHTHL 112
                      8999******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.2E-22564IPR009057Homeodomain-like
PROSITE profilePS5129416.047961IPR017930Myb domain
SuperFamilySSF466891.37E-2911108IPR009057Homeodomain-like
SMARTSM007172.1E-121363IPR001005SANT/Myb domain
PfamPF002492.4E-131461IPR001005SANT/Myb domain
CDDcd001675.56E-91661No hitNo description
PROSITE profilePS5129426.86662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.0E-2665115IPR009057Homeodomain-like
SMARTSM007174.2E-1766114IPR001005SANT/Myb domain
PfamPF002493.0E-1667112IPR001005SANT/Myb domain
CDDcd001679.16E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MVKSPCCERI GLKKGTWTLE EDQKLIAYIK RYGHWNWLQL PKYAGLSRCG KSCRLRWMNY  60
LRPDIKRGNY SREEEEAIIN LHEKLGNKWT AIAARLPGRT DNEIKNHWHT HLKKRVGQNQ  120
MEAKIHPVEL SYCEANQKAA ELEANYASIH KSPKRPKLET CSSNDRVSPK ESCEYDSGRN  180
SNFSLGIGKN TSKEESVGSP KAVAELELDG SFWAKQFSMA ESFYQESFGT FFAGDGFMLP  240
VSPVSLEEIV YSYGSNRDDR VEFEFNLDEE CLVGLS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-28121165108B-MYB
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010277889.10.0PREDICTED: myb-related protein Myb4-like
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G31180.11e-63myb domain protein 14